CHAD Antikörper (Chondroadherin)

Details for Product anti-CHAD Antibody No. ABIN4263283, Anbieter: Anmelden zum Anzeigen
  • CHAD
  • zgc:63475
  • SLRR4A
  • chondroadherin
  • chondroadherin-like
  • CHAD
  • chad
  • LOC100034030
  • Chad
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CHAD(chondroadherin) The peptide sequence was selected from the middle region of Chondroadherin. Peptide sequence LSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALD.
Reinigung Immunogen affinity purified
Andere Bezeichnung Chondroadherin (CHAD Antibody Abstract)
Hintergrund Gene Symbol: CHAD
Gen-ID 1101
UniProt O15335
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CHAD and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.