Choline Kinase alpha Antikörper (CHKA)

Details for Product anti-CHKA Antibody No. ABIN4263281, Anbieter: Anmelden zum Anzeigen
Antigen
  • im:7143625
  • wu:fd46h01
  • si:dkey-12e7.3
  • CHKA
  • chkb
  • ATCK1
  • CHOLINE KINASE
  • CK
  • F14O23.8
  • F14O23_8
  • choline kinase 1
  • CHK
  • CKI
  • EK
  • CK/EK-alpha
  • Chetk-alpha
  • Chk
  • ChoK
  • EtnK-alpha
  • CK-R
  • choline kinase alpha
  • choline kinase
  • choline kinase 1
  • chka
  • CHKA
  • MCYG_00090
  • PF14_0020
  • CK1
  • CNI01400
  • Chka
Reaktivität
Human
43
20
11
6
3
3
2
2
2
1
1
1
Wirt
Kaninchen
51
4
Klonalität
Polyklonal
Konjugat
Dieser Choline Kinase alpha Antikörper ist unkonjugiert
6
2
2
2
2
2
Applikation
Western Blotting (WB)
53
30
12
9
5
3
3
3
3
3
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CHKA(choline kinase alpha) The peptide sequence was selected from the middle region of CHKA (NP_001268). Peptide sequence LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI.
Reinigung Immunogen affinity purified
Andere Bezeichnung Choline Kinase alpha (CHKA Antibody Abstract)
Hintergrund Gene Symbol: CHKA
Molekulargewicht Theoretical MW: 52 kDa
Gen-ID 1119
UniProt P35790
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CHKA and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.