CHMP1B Antikörper (Charged Multivesicular Body Protein 1B) (N-Term)

Details for Product anti-CHMP1B Antibody No. ABIN4263253, Anbieter: Anmelden zum Anzeigen
  • C10orf2
  • C18-ORF2
  • C18orf2
  • CHMP1.5
  • Vps46-2
  • Vps46B
  • hVps46-2
  • 2810405I11Rik
  • Chmp1b1
  • Chmp1.5
  • fb10c03
  • wu:fb10c03
  • zgc:56134
  • chromatin modifying protein 1b
  • chromatin modifying protein 1B
  • charged multivesicular body protein 1B
  • LOC692931
  • PGTG_18215
  • LOC100218471
  • CHMP1B
  • Chmp1b
  • chmp1b
Dieser CHMP1B Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CHMP1B(chromatin modifying protein 1B) Antibody(against the N terminal of CHMP1B. Peptide sequence KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHMP1B (CHMP1B Antibody Abstract)
Hintergrund Gene Symbol: CHMP1B
Molekulargewicht Theoretical MW: 22 kDa
Gen-ID 57132
UniProt Q7LBR1
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CHMP1B and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?