CHM Antikörper (Choroideremia (Rab Escort Protein 1)) (N-Term)

Details for Product anti-CHM Antibody No. ABIN4263251, Anbieter: Anmelden zum Anzeigen
Antigen
  • REP1
  • CHM
  • DKFZp459K2154
  • tcd
  • ggta
  • rep-1
  • dxs540
  • hsd-32
  • MGC68578
  • DXS540
  • GGTA
  • HSD-32
  • REP-1
  • TCD
  • Rep-1
  • 1110004P21Rik
  • 2810416M14Rik
  • 5730453G22Rik
  • 9030402K04Rik
  • AU021830
  • D4Ertd314e
  • Gm12940
  • OTTMUSG00000009329
  • PSF
  • choroideremia (Rab escort protein 1)
  • choroideremia
  • choroidermia
  • splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated)
  • chm
  • CHM
  • Chm
  • Sfpq
Alternativen
anti-Human CHM Antikörper für ELISA
Epitop
N-Term
18
10
7
4
2
1
1
1
Reaktivität
Human
31
4
3
3
2
2
2
2
2
2
2
2
2
2
2
2
1
1
Wirt
Kaninchen
30
2
Klonalität
Polyklonal
Konjugat
Dieser CHM Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
27
16
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptide directed towards the N terminal of human CHMThe immunogen for this antibody is CHM. Peptide sequence LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHM (CHM Antibody Abstract)
Hintergrund Gene Symbol: CHM
Molekulargewicht Theoretical MW: 73 kDa
Gen-ID 1121
NCBI Accession NP_000381
Forschungsgebiet Signaling
Pathways Sensory Perception of Sound
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CHM and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.