CHIC1 Antikörper (Cysteine-Rich Hydrophobic Domain 1) (N-Term)

Details for Product anti-CHIC1 Antibody No. ABIN4263029, Anbieter: Anmelden zum Anzeigen
  • wu:fj33g02
  • BRX
  • Brx
  • cysteine-rich hydrophobic domain 1
  • chic1
  • CHIC1
  • Chic1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren


Immunogen Synthetic peptide directed towards the N terminal of human CHIC1. Peptide sequence LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV.
Reinigung Protein A purified
Andere Bezeichnung CHIC1
Hintergrund Gene Symbol: CHIC1
Gen-ID 53344
NCBI Accession NP_001034929
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CHIC1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-CHIC1 Antikörper (Cysteine-Rich Hydrophobic Domain 1) (N-Term) (ABIN4263029) Western Blot: CHIC1 Antibody [NBP1-91589] - Titration: 5.0ug/ml Positive Control: Jur...