Chitinase, Acidic (CHIA) Antikörper

Details zu Produkt Nr. ABIN4263026, Anbieter: Anmelden zum Anzeigen
  • chia-a
  • CHIT2
  • TSA1902
  • 2200003E03Rik
  • AMCase
  • YNL
  • CHIA
  • chioIIa
  • fa55g10
  • wu:fa55g10
  • zgc:63792
  • chitinase, acidic
  • chitinase, acidic.4
  • CHIA
  • chia
  • Chia
  • chia.4
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CHIA(chitinase, acidic) The peptide sequence was selected from the middle region of CHIA. Peptide sequence GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHIA (CHIA Antibody Abstract)
Hintergrund Gene Symbol: CHIA
Gen-ID 27159
Forschungsgebiet Immunology, Cytokines, Innate Immunity
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CHIA and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?