Chitinase, Acidic (CHIA) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4263024, Anbieter: Anmelden zum Anzeigen
Antigen
  • chia-a
  • AMCASE
  • CHIT2
  • TSA1902
  • 2200003E03Rik
  • AMCase
  • YNL
  • CHIA
  • chioIIa
  • fa55g10
  • wu:fa55g10
  • zgc:63792
  • chitinase, acidic
  • chitinase, acidic.4
  • CHIA
  • chia
  • Chia
  • chia.4
Epitop
N-Term
21
6
3
2
2
1
1
Reaktivität
Human
49
23
12
4
3
3
2
2
2
1
Wirt
Kaninchen
46
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
48
21
17
7
5
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CHIA(chitinase, acidic) The peptide sequence was selected from the N terminal of CHIA. Peptide sequence MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHIA (CHIA Antibody Abstract)
Hintergrund Gene Symbol: CHIA
Gen-ID 27159
Forschungsgebiet Immunology, Cytokines, Innate Immunity
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CHIA and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.