CSGALNACT1 Antikörper (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1) (N-Term)

Details for Product anti-CSGALNACT1 Antibody No. ABIN4263020, Anbieter: Anmelden zum Anzeigen
  • CSGalNAcT-1
  • ChGn
  • beta4GalNAcT
  • CHGN
  • 4732435N03Rik
  • Chgn
  • RGD1307618
  • chondroitin sulfate N-acetylgalactosaminyltransferase 1
  • csgalnact1
  • Csgalnact1
anti-Human CSGALNACT1 Antikörper für ELISA
Dieser CSGALNACT1 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CSGALNACT1 The peptide sequence was selected from the N terminal of CSGALNACT1. Peptide sequence KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE.
Reinigung Immunogen affinity purified
Andere Bezeichnung ChGn (CSGALNACT1 Antibody Abstract)
Hintergrund Gene Symbol: CSGALNACT1
Gen-ID 55790
UniProt Q8TDX6
Pathways Glycosaminoglycan Metabolic Process
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CSGALNACT1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.