CHERP Antikörper (Calcium Homeostasis Endoplasmic Reticulum Protein)

Details for Product anti-CHERP Antibody No. ABIN4263016, Anbieter: Anmelden zum Anzeigen
Antigen
  • cherp
  • MGC53695
  • CHERP
  • DAN16
  • SCAF6
  • SRA1
  • ik:tdsubc_2h12
  • scaf6
  • wu:fc83d01
  • xx:tdsubc_2h12
  • zgc:55518
  • 5730408I11Rik
  • D8Wsu96e
  • Scaf6
  • calcium homeostasis endoplasmic reticulum protein
  • cherp
  • CHERP
  • Tsp_15667
  • Cherp
Reaktivität
Human
56
15
14
7
4
4
4
3
2
2
2
2
1
Wirt
Kaninchen
39
17
Klonalität
Polyklonal
Konjugat
Dieser CHERP Antikörper ist unkonjugiert
4
3
3
3
3
3
Applikation
Western Blotting (WB)
54
28
4
2
2
2
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptide directed towards the middle region of human CHERP. Peptide sequence SERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKR.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHERP (CHERP Antibody Abstract)
Hintergrund Gene Symbol: CHERP
Gen-ID 10523
NCBI Accession NP_006378
Forschungsgebiet Signaling
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CHERP and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.