CHD1L Antikörper (Chromodomain Helicase DNA Binding Protein 1-Like)

Details for Product anti-CHD1L Antibody No. ABIN4262993, Anbieter: Anmelden zum Anzeigen
  • CHD1L
  • ALC1
  • CHDL
  • 4432404A22Rik
  • Alc1
  • Snf2p
  • zgc:56084
  • chromodomain helicase DNA binding protein 1 like
  • chromodomain helicase DNA binding protein 1-like
  • CHD1L
  • chd1l
  • Chd1l
Dieser CHD1L Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CHD1L (chromodomain helicase DNA binding protein 1-like) The peptide sequence was selected from the middle region of CHD1L. Peptide sequence DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL.
Reinigung Protein A purified
Andere Bezeichnung CHD1L (CHD1L Antibody Abstract)
Hintergrund Gene Symbol: CHD1L
Gen-ID 9557
UniProt Q9H678
Forschungsgebiet DNA/RNA, Chromatin and Nuclear Signaling
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CHD1L and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?