Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 6 (CHCHD6) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4262989, Anbieter: Anmelden zum Anzeigen
Antigen
  • CHCM1
  • PPP1R23
  • 0710001P09Rik
  • 1700021B03Rik
  • chchd6
  • hm:zeh0124
  • zgc:91802
  • coiled-coil-helix-coiled-coil-helix domain containing 6
  • coiled-coil-helix-coiled-coil-helix domain containing 6a
  • CHCHD6
  • Chchd6
  • chchd6a
Epitop
N-Term
10
9
8
8
7
2
1
1
Reaktivität
Human
60
17
15
2
1
1
1
Wirt
Kaninchen
60
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
46
24
13
9
7
2
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of human CHCHD6The immunogen for this antibody is CHCHD6. Peptide sequence LPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKA.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHCHD6 (CHCHD6 Antibody Abstract)
Hintergrund Gene Symbol: CHCHD6
Molekulargewicht Theoretical MW: 26 kDa
Gen-ID 84303
NCBI Accession NP_115719
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CHCHD6 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?