Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3) Antikörper

Details zu Produkt Nr. ABIN4262986, Anbieter: Anmelden zum Anzeigen
  • plxna4
  • FLJ20420
  • wu:fe23h05
  • zgc:111837
  • si:rp71-18a24.1
  • MGC80265
  • MGC88973
  • MINOS3
  • PPP1R22
  • 0610041L09Rik
  • 1700039J09Rik
  • AW558177
  • coiled-coil-helix-coiled-coil-helix domain containing 3a
  • coiled-coil-helix-coiled-coil-helix domain containing 3
  • coiled-coil-helix-coiled-coil-helix domain containing 3 L homeolog
  • coiled-coil-helix-coiled-coil-helix domain containing 3 pseudogene
  • chchd3a
  • CHCHD3
  • chchd3.L
  • chchd3
  • LOC698080
  • LOC710769
  • LOC100229580
  • Chchd3
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CHCHD3(coiled-coil-helix-coiled-coil-helix domain containing 3) The peptide sequence was selected from the middle region of CHCHD3. Peptide sequence LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHCHD3 (CHCHD3 Antibody Abstract)
Hintergrund Gene Symbol: CHCHD3
Gen-ID 54927
UniProt Q9NX63
Forschungsgebiet Signaling, Metabolism, Organelles
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CHCHD3 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?