Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3) Antikörper

Details zu Produkt Nr. ABIN4262986, Anbieter: Anmelden zum Anzeigen
Antigen
  • plxna4
  • FLJ20420
  • wu:fe23h05
  • zgc:111837
  • si:rp71-18a24.1
  • MGC80265
  • MGC88973
  • MINOS3
  • PPP1R22
  • 0610041L09Rik
  • 1700039J09Rik
  • AW558177
  • coiled-coil-helix-coiled-coil-helix domain containing 3
  • chchd3
  • CHCHD3
  • LOC100229580
  • Chchd3
Reaktivität
Human
56
10
10
8
8
7
4
4
3
3
2
1
1
Wirt
Kaninchen
31
13
12
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
54
27
8
7
4
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CHCHD3(coiled-coil-helix-coiled-coil-helix domain containing 3) The peptide sequence was selected from the middle region of CHCHD3. Peptide sequence LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHCHD3 (CHCHD3 Antibody Abstract)
Hintergrund Gene Symbol: CHCHD3
Gen-ID 54927
UniProt Q9NX63
Forschungsgebiet Signaling, Metabolism, Organelles
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CHCHD3 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.