CHCHD1 Antikörper (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1)

Details for Product anti-CHCHD1 Antibody No. ABIN4262984, Anbieter: Anmelden zum Anzeigen
Antigen
  • c2360
  • MGC97719
  • im:7162785
  • zgc:162640
  • C10orf34
  • C2360
  • 1110001O19Rik
  • 2400010G13Rik
  • coiled-coil-helix-coiled-coil-helix domain containing 1
  • Chchd1
  • chchd1
  • CHCHD1
Reaktivität
Human
17
9
9
4
3
3
2
2
2
2
Wirt
Kaninchen
17
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
16
4
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CHCHD1 (coiled-coil-helix-coiled-coil-helix domain containing 1) The peptide sequence was selected from the middle region of CHCHD1)(50ug). Peptide sequence KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNK
Reinigung Immunogen affinity purified
Andere Bezeichnung CHCHD1
Hintergrund Gene Symbol: CHCHD1
Gen-ID 118487
UniProt Q96BP2
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CHCHD1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.