CGI-16 (C-Term) Antikörper

Details zu Produkt Nr. ABIN4262948, Anbieter: Anmelden zum Anzeigen
Antigen
Epitop
C-Term
1
1
Reaktivität
Human
3
Wirt
Kaninchen
3
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
3
2
2
2
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to the C terminal of ACOT9. Immunizing peptide sequence FLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVF.
Reinigung Immunogen affinity purified
Hintergrund Gene Symbol: ACOT9
Molekulargewicht Theoretical MW: 23 kDa
Gen-ID 23597
UniProt Q96EA2
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against ACOT9 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.