CGI 62 Antikörper

Details zu Produkt Nr. ABIN4262946, Anbieter: Anmelden zum Anzeigen
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the middle region of human C8orf70. Peptide sequence QAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQP.
Reinigung Immunogen affinity purified
Hintergrund Gene Symbol: ZC2HC1A
Molekulargewicht Theoretical MW: 35 kDa
Gen-ID 51101
NCBI Accession NP_057094
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against C8orf70 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?