CETP Antikörper (Cholesteryl Ester Transfer Protein)

Details for Product anti-CETP Antibody No. ABIN4262924, Anbieter: Anmelden zum Anzeigen
  • HDLCQ10
  • hdlcq10
  • cholesteryl ester transfer protein, plasma
  • CETP
  • cetp
  • Cetp
Dieser CETP Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CETP(cholesteryl ester transfer protein, plasma) The peptide sequence was selected from the middle region of CETP. Peptide sequence KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV.
Reinigung Immunogen affinity purified
Andere Bezeichnung CETP (CETP Antibody Abstract)
Hintergrund Gene Symbol: CETP
Gen-ID 1071
UniProt P11597
Forschungsgebiet Atherosclerosis, Cancer
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CETP and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.