Carboxylesterase 2A (CES2A) Antikörper

Details zu Produkt Nr. ABIN4262915, Anbieter: Anmelden zum Anzeigen
Antigen
Reaktivität
Maus
2
1
Wirt
Kaninchen
2
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the middle region of human CES6. Peptide sequence MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL.
Reinigung Protein A purified
Andere Bezeichnung Ces2a
Hintergrund Gene Symbol: CES6
Molekulargewicht Theoretical MW: 61 kDa
Gen-ID 102022
NCBI Accession NP_598721
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CES6 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?