CEP295NL Antikörper

Details zu Produkt Nr. ABIN4262899, Anbieter: Anmelden zum Anzeigen
Antigen
Reaktivität
Human
2
Wirt
Kaninchen
2
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC)
2
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:CSGWSSSVIWRHTQFAVERCGFCGSSGPGAPLEPSTLGSKHLPWEAVSAGFADRNRNMDGAMWLSLCPDNEDLLWRKKHKLLQAR
Isotyp IgG
Reinigung Immunogen affinity purified
Hintergrund Gene Symbol: DDC8
Gen-ID 100653515
Applikationshinweise Immunohistochemistry 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-CEP295NL antibody (ABIN4262899) Immunohistochemistry: CEP295NL Antibody [NBP2-48574] - Staining of human testis shows...
Immunofluorescence (IF) image for anti-CEP295NL antibody (ABIN4262899) Immunocytochemistry/Immunofluorescence: CEP295NL Antibody - Immunofluorescent staini...
Haben Sie etwas anderes gesucht?