CENPQ Antikörper (Centromere Protein Q) (N-Term)

Details for Product anti-CENPQ Antibody No. ABIN4262889, Anbieter: Anmelden zum Anzeigen
Antigen
  • C6orf139
  • CENP-Q
  • 2610528M18Rik
  • centromere protein Q
  • Centromere protein Q
  • CENPQ
  • LOC100227510
  • cenpq
  • Cenpq
Epitop
N-Term
3
3
1
1
1
Reaktivität
Human
23
3
1
1
1
1
1
1
1
1
Wirt
Kaninchen
17
6
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
20
11
10
4
3
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CENPQ(centromere protein Q) The peptide sequence was selected from the N terminal of CENPQ. Peptide sequence VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CENPQ (CENPQ Antibody Abstract)
Hintergrund Gene Symbol: CENPQ
Molekulargewicht Theoretical MW: 30 kDa
Gen-ID 55166
UniProt Q7L2Z9
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CENPQ and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.