CENPP Antikörper (Centromere Protein P) (N-Term)

Details for Product anti-CENPP Antibody No. ABIN4262887, Anbieter: Anmelden zum Anzeigen
Antigen
  • CENP-P
  • 1700022C02Rik
  • 4921518G09Rik
  • si:ch211-103f16.3
  • wu:fb81h12
  • zgc:101125
  • centromere protein P
  • CENPP
  • LOC100226998
  • LOC100357196
  • Cenpp
  • cenpp
Epitop
N-Term
7
3
3
2
2
2
1
1
Reaktivität
Human
22
5
3
2
1
Wirt
Kaninchen
14
8
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
20
7
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CENPP(centromere protein P) The peptide sequence was selected from the N terminal of CENPP. Peptide sequence VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ.
Reinigung Immunogen affinity purified
Andere Bezeichnung CENPP (CENPP Antibody Abstract)
Hintergrund Gene Symbol: CENPP
Gen-ID 401541
UniProt Q6IPU0
Forschungsgebiet Cell Cycle, Chromatin and Nuclear Signaling
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CENPP and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.