Centromere Protein B (CENPB) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4262881, Anbieter: Anmelden zum Anzeigen
Antigen
  • CENPB
  • CENP-B
  • CENP-B protein
  • centromere protein B
  • centromere protein B-like
  • centromere protein B, 80kDa
  • CENP-B
  • Cenpb
  • LOC100356278
  • CENPB
Epitop
C-Term
8
6
2
1
1
Reaktivität
Human
40
16
16
2
2
2
1
1
1
1
Wirt
Kaninchen
37
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
16
13
12
11
4
4
4
3
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CENPB(centromere protein B, 80kDa) The peptide sequence was selected from the C terminal of CENPB. Peptide sequence GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK.
Reinigung Immunogen affinity purified
Andere Bezeichnung CENPB (CENPB Antibody Abstract)
Hintergrund Gene Symbol: CENPB
Gen-ID 1059
UniProt P07199
Forschungsgebiet Cell Cycle, Chromatin and Nuclear Signaling
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CENPB and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.