CEACAM16 Antikörper (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16)

Details for Product anti-CEACAM16 Antibody No. ABIN4262836, Anbieter: Anmelden zum Anzeigen
  • CEAL2
  • DFNA4B
  • Gm769
  • Bcl3
  • carcinoembryonic antigen-related cell adhesion molecule 16
  • CEACAM16
  • Ceacam16
anti-Human CEACAM16 Antikörper für Cell-ELISA
Dieser CEACAM16 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CEACAM16(carcinoembryonic antigen-related cell adhesion molecule 16) The peptide sequence was selected from the middle region of CEACAM16. Peptide sequence LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLV
Reinigung Immunogen affinity purified
Andere Bezeichnung CEACAM16 (CEACAM16 Antibody Abstract)
Hintergrund Gene Symbol: CEACAM16
Molekulargewicht Theoretical MW: 53 kDa
Gen-ID 388551
Pathways Sensory Perception of Sound
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CEACAM16 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.