CEACAM19 Antikörper (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 19) (N-Term)

Details for Product anti-CEACAM19 Antibody No. ABIN4262815, Anbieter: Anmelden zum Anzeigen
Antigen
  • CEAL1
  • C130022P09Rik
  • carcinoembryonic antigen-related cell adhesion molecule 19
  • CEACAM19
  • Ceacam19
Epitop
N-Term
2
1
Reaktivität
Human
38
1
1
Wirt
Kaninchen
30
8
Klonalität
Polyklonal
Konjugat
Dieser CEACAM19 Antikörper ist unkonjugiert
2
2
2
2
2
2
2
2
2
2
2
2
1
Applikation
Western Blotting (WB)
33
3
3
2
2
2
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to SEMA4B(sema domain, immunoglobulin domain (Ig), (semaphorin) 4B) The peptide sequence was selected form the N terminal of SEMA4B. Peptide sequence KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS.
Reinigung Immunogen affinity purified
Andere Bezeichnung CEACAM-19
Hintergrund Gene Symbol: SEMA4B
Gen-ID 10509
UniProt Q2NL81
Applikationshinweise Western BlotThis is a rabbit polyclonal antibody against SEMA4B and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.