Caudal Type Homeobox 1 (CDX1) Antikörper

Details zu Produkt Nr. ABIN4262747, Anbieter: Anmelden zum Anzeigen
Antigen
  • cdx-1
  • xcad2
  • xtcad2
  • CDX1
  • Cdx
  • Cdx-1
  • CDX-A
  • CDXA
  • CHOX-CAD1
  • CHox-cad
  • xCAD2
  • caudal type homeobox 1
  • caudal type homeo box 1
  • cdx1
  • CDX1
  • Cdx1
Reaktivität
Maus
119
51
22
6
6
6
5
4
3
3
3
3
2
2
1
1
Wirt
Kaninchen
69
53
Klonalität
Polyklonal
Konjugat
Unkonjugiert
6
6
6
4
4
4
4
4
3
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
79
47
35
25
22
19
13
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide towards Cdx1. Peptide sequence ERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSGPPLG.
Reinigung Immunogen affinity purified
Andere Bezeichnung Cdx1 (CDX1 Antibody Abstract)
Hintergrund Gene Symbol: CDX1
Gen-ID 1044
NCBI Accession NP_034010
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against Cdx1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?