DTL Antikörper (Denticleless E3 Ubiquitin Protein Ligase Homolog (Drosophila)) (N-Term)

Details for Product anti-DTL Antibody No. ABIN4262737, Anbieter: Anmelden zum Anzeigen
Antigen
  • CDT2
  • DCAF2
  • L2DTL
  • RAMP
  • RGD1310439
  • 2810047L02Rik
  • 5730564G15Rik
  • Ramp
  • denticleless E3 ubiquitin protein ligase homolog (Drosophila)
  • denticleless homolog (Drosophila)
  • DTL
  • Dtl
Epitop
N-Term
19
9
7
5
3
3
2
1
1
1
1
1
Reaktivität
Human
48
24
8
2
2
2
2
2
1
1
1
Wirt
Kaninchen
47
1
Klonalität
Polyklonal
Konjugat
Dieser DTL Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
41
18
18
9
6
5
4
3
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CDT2. The peptide sequence was selected from the N terminal of CDT2 (NP_057532). Peptide sequence VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV.
Reinigung Immunogen affinity purified
Andere Bezeichnung CDT2 (DTL Antibody Abstract)
Hintergrund Gene Symbol: DTL
Molekulargewicht Theoretical MW: 79 kDa
Gen-ID 51514
UniProt Q9NZJ0
Forschungsgebiet Proteolysis / Ubiquitin
Applikationshinweise Western Blot 0.2-1 μg/mLThe observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?