CDR2L Antikörper (Cerebellar Degeneration-Related Protein 2-Like) (C-Term)

Details for Product anti-CDR2L Antibody No. ABIN4262732, Anbieter: Anmelden zum Anzeigen
  • RGD1306881
  • D030068L24Rik
  • Gm21
  • fj58a11
  • wu:fj58a11
  • zgc:77462
  • cerebellar degeneration-related protein 2-like
  • Cdr2l
  • CDR2L
  • LOC100148175
  • LOC100395257
  • LOC100440046
  • LOC100541938
  • LOC100547233
  • LOC100559051
  • cdr2l
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the C terminal of human CDR2L. Peptide sequence VQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPE.
Reinigung Immunogen affinity purified
Andere Bezeichnung CDR2L
Hintergrund Gene Symbol: CDR2L
Molekulargewicht Theoretical MW: 53 kDa
Gen-ID 30850
NCBI Accession NP_055418
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CDR2L and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?