Cyclin-Dependent Kinase-Like 2 (CDC2-Related Kinase) (KKIAMRE) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4262726, Anbieter: Anmelden zum Anzeigen
Antigen
  • zgc:101002
  • CDKL2
  • DKFZp459L235
  • KKIAMRE
  • P56
  • kkiamre
  • 5330436L21Rik
  • AI505225
  • Kkm
  • cyclin-dependent kinase-like 1 (CDC2-related kinase)
  • cyclin-dependent kinase-like 2 (CDC2-related kinase)
  • cyclin-dependent kinase-like 1
  • cdkl1
  • CDKL2
  • CDKL1
  • BACOIKO006_03
  • cdkl2
  • Cdkl2
Epitop
N-Term
12
10
5
4
3
3
3
2
1
1
Reaktivität
Human
48
4
3
3
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
25
23
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
47
18
15
10
6
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CDKL2(cyclin-dependent kinase-like 2 (CDC2-related kinase)) The peptide sequence was selected from the N terminal of CDKL2. Peptide sequence MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR.
Reinigung Immunogen affinity purified
Andere Bezeichnung CDKL2 (KKIAMRE Antibody Abstract)
Hintergrund Gene Symbol: CDKL2
Gen-ID 8999
UniProt Q92772
Forschungsgebiet Signaling
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CDKL2 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?