CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4262723, Anbieter: Anmelden zum Anzeigen
  • cdk5rap1
  • MGC154823
  • C20orf34
  • C42
  • CGI-05
  • HSPC167
  • 2310066P17Rik
  • CDK5 regulatory subunit associated protein 1
  • zgc:162738
  • CDK5RAP1
  • cdk5rap1
  • zgc:162738
  • Cdk5rap1
Ratte (Rattus)
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the C terminal of human Cdk5rap1The immunogen for this antibody is Cdk5rap1. Peptide sequence VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD.
Reinigung Immunogen affinity purified
Andere Bezeichnung CDK5RAP1 (CDK5RAP1 Antibody Abstract)
Hintergrund Gene Symbol: CDK5RAP1
Molekulargewicht Theoretical MW: 65 kDa
Gen-ID 51654
NCBI Accession NP_663773
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against Cdk5rap1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?