CDC14A Antikörper (CDC14 Cell Division Cycle 14 Homolog A (S. Cerevisiae)) (C-Term)

Details for Product anti-CDC14A Antibody No. ABIN4262556, Anbieter: Anmelden zum Anzeigen
Antigen
  • xcdc14a
  • A830059A17Rik
  • CDC14A2
  • CDC14a1
  • Cdc14
  • cdc14
  • hCDC14
  • Dual specificity protein phosphatase CDC14A
  • dual specificity protein phosphatase CDC14A
  • cell division cycle 14A
  • CDC14 cell division cycle 14 homolog A (S. cerevisiae)
  • CDC14 cell division cycle 14A
  • TVAG_168700
  • TVAG_479730
  • TVAG_362610
  • TVAG_490830
  • GL50803_9270
  • CMU_014610
  • cdc14a
  • CDC14A
  • Cdc14a
Epitop
C-Term
15
13
10
9
8
5
3
2
1
1
1
Reaktivität
Human
84
32
22
2
1
1
1
1
1
Wirt
Kaninchen
66
18
Klonalität
Polyklonal
Konjugat
Dieser CDC14A Antikörper ist unkonjugiert
6
6
6
5
5
5
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
66
50
15
15
13
10
9
6
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen The immunogen for this antibody is CDC14A - C-terminal region. Peptide sequence DDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDDTKGHPRAVSQPFR.
Reinigung Immunogen affinity purified
Andere Bezeichnung Cdc14A (CDC14A Antibody Abstract)
Hintergrund Gene Symbol: CDC14A
Molekulargewicht Theoretical MW: 66 kDa
Gen-ID 8556
NCBI Accession NP_003663
Forschungsgebiet Cell Cycle
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.