CD84 Molecule (CD84) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4262337, Anbieter: Anmelden zum Anzeigen
  • RGD1564553
  • A130013D22Rik
  • CDw84
  • SLAMF5
  • LY9B
  • hCD84
  • mCD84
  • CD84 molecule
  • CD84 antigen
  • Cd84
  • CD84
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen The immunogen for this antibody is CD84 - C-terminal region. Peptide sequence: LLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQ
Reinigung Immunogen affinity purified
Andere Bezeichnung CD84/SLAMF5 (CD84 Antibody Abstract)
Hintergrund Gene Symbol: CD84
Molekulargewicht Theoretical MW: 24 kDa
Gen-ID 8832
NCBI Accession NP_001171811
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.