Pancreatickininogenase (PK) Antikörper

Details zu Produkt Nr. ABIN4261904, Anbieter: Anmelden zum Anzeigen
Antigen
  • Gb3
  • A14GALT
  • A4GALT1
  • Gb3S
  • P(k)
  • P1
  • P1PK
  • PK
  • alpha 1,4-galactosyltransferase
  • A4galt
  • A4GALT
Reaktivität
Human
4
Wirt
Kaninchen
4
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
3
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT (NP_059132). Peptide sequence RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAF
Reinigung Immunogen affinity purified
Andere Bezeichnung CD77 Synthase (PK Antibody Abstract)
Hintergrund Gene Symbol: A4GALT
Molekulargewicht Theoretical MW: 40 kDa
Gen-ID 53947
UniProt Q9NPC4
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against A4GALT and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.