CD58 Antikörper (CD58 Molecule) (C-Term)

Details for Product anti-CD58 Antibody No. ABIN4261630, Anbieter: Anmelden zum Anzeigen
Antigen
  • LFA-3
  • LFA3
  • ag3
  • CD58 molecule
  • CD58
Epitop
C-Term
15
12
11
6
6
5
4
4
4
3
3
2
1
1
1
Reaktivität
Human
239
23
17
8
5
1
Wirt
Kaninchen
206
56
Klonalität
Polyklonal
Konjugat
Dieser CD58 Antikörper ist unkonjugiert
36
31
21
11
5
5
4
4
4
3
3
3
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
183
60
27
20
20
16
13
11
6
5
5
4
2
1
1
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen The immunogen for this antibody is LFA3 - C-terminal region. Peptide sequence SIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTK.
Reinigung Immunogen affinity purified
Andere Bezeichnung CD58/LFA-3 (CD58 Antibody Abstract)
Hintergrund Gene Symbol: CD58
Molekulargewicht Theoretical MW: 27 kDa
Gen-ID 965
NCBI Accession NP_001138294
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.