Ectonucleoside Triphosphate diphosphohydrolase 1 (ENTPD1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4260716, Anbieter: Anmelden zum Anzeigen
Antigen
  • ENTPD1
  • MGC80631
  • zgc:100819
  • entpd1
  • MGC79567
  • ATPDase
  • CD39
  • NTPDase-1
  • 2610206B08Rik
  • AA408691
  • Cd39
  • ectonucleoside triphosphate diphosphohydrolase 8
  • ectonucleoside triphosphate diphosphohydrolase 1
  • ENTPD8
  • entpd1
  • ENTPD1
  • Entpd1
Epitop
N-Term
29
9
6
3
3
3
2
1
1
1
1
1
1
1
1
1
Reaktivität
Maus
153
89
36
5
4
4
4
2
1
1
1
1
Wirt
Kaninchen
120
43
42
5
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
23
14
9
9
7
6
6
4
4
4
4
4
4
2
2
2
2
2
2
2
2
2
2
2
2
1
1
Applikation
Western Blotting (WB)
120
107
54
26
24
23
14
8
6
4
2
2
2
2
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is CD39 - N-terminal region. Peptide sequence YGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKT.
Reinigung Immunogen affinity purified
Andere Bezeichnung CD39/ENTPD1 (ENTPD1 Antibody Abstract)
Hintergrund Gene Symbol: ENTPD1
Molekulargewicht Theoretical MW: 57 kDa
Gen-ID 953
NCBI Accession NP_033978
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?