CD160 Antikörper (CD160 Molecule)

Details for Product anti-CD160 Antibody No. ABIN4259418, Anbieter: Anmelden zum Anzeigen
  • CD160
  • RGD1563598
  • BY55
  • AU045688
  • By55
  • NK1
  • NK28
  • CD160 molecule
  • CD160 antigen
  • CD160
  • Cd160
Dieser CD160 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CD160(CD160 molecule) The peptide sequence was selected from the middle region of CD160. Peptide sequence SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG.
Reinigung Immunogen affinity purified
Andere Bezeichnung CD160 (CD160 Antibody Abstract)
Hintergrund Gene Symbol: CD160
Gen-ID 11126
UniProt O95971
Forschungsgebiet Adaptive Immunity, Immunology, Innate Immunity, Surface Receptors of Immune Cells, CD Antigens
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CD160 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1 mg/mL. Vortex followed by Centrifuge again to pellet the solution.
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-CD160 Molecule (CD160) antibody (ABIN4259418) Western Blot: CD160 Antibody [NBP1-58868] - THP-1 cell lysate, concentration 0.2-1 ug...
Haben Sie etwas anderes gesucht?