CCZ1 Antikörper (CCZ1 Vacuolar Protein Trafficking and Biogenesis Associated Homolog (S. Cerevisiae)) (C-Term)

Details for Product anti-CCZ1 Antibody No. ABIN4259107, Anbieter: Anmelden zum Anzeigen
Antigen
  • AU022870
  • C7orf28A
  • CCZ1A
  • H_DJ1163J12.2
  • C25H7orf28A
  • RGD1306410
  • zgc:55344
  • CCZ1 vacuolar protein trafficking and biogenesis associated
  • CCZ1 vacuolar protein trafficking and biogenesis associated homolog (S. cerevisiae)
  • Ccz1
  • CCZ1
  • ccz1
Epitop
C-Term
12
9
8
7
4
1
1
Reaktivität
Human
43
30
16
3
2
1
1
1
1
1
Wirt
Kaninchen
43
Klonalität
Polyklonal
Konjugat
Dieser CCZ1 Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
29
17
16
13
8
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is C7orf28B - C-terminal region. Peptide sequence NKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPSVSLTSVHPDLMKIL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CCZ1
Hintergrund Gene Symbol: CCZ1B
Molekulargewicht Theoretical MW: 56 kDa
Gen-ID 221960
UniProt P86790
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?