Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8) (C-Term), (Isoform theta) Antikörper

Details zu Produkt Nr. ABIN4259105, Anbieter: Anmelden zum Anzeigen
  • CCT8
  • DKFZp469C2223
  • MGC89698
  • C21orf112
  • Cctq
  • D21S246
  • PRED71
  • AI132397
  • Tcpq
  • fa22h09
  • wu:fa22h09
  • zgc:56059
  • chaperonin containing TCP1, subunit 8 (theta)
  • chaperonin containing Tcp1, subunit 8 (theta)
  • Protein CCT-8
  • CCT8
  • cct8
  • Cct8
  • cct-8
C-Term, Isoform theta
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CCT8(chaperonin containing TCP1, subunit 8 (theta)) The peptide sequence was selected from the C terminal of CCT8. Peptide sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK.
Spezifität This product is specific to Subunit or Isoform: theta.
Reinigung Immunogen affinity purified
Andere Bezeichnung CCT8 (CCT8 Antibody Abstract)
Hintergrund Gene Symbol: CCT8
Gen-ID 10694
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CCT8 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?