CCNYL1 Antikörper (Cyclin Y-Like 1) (N-Term)

Details for Product anti-CCNYL1 Antibody No. ABIN4258849, Anbieter: Anmelden zum Anzeigen
Antigen
  • 9630037P07Rik
  • AW554339
  • RGD1310683
  • ccnyl1
  • MGC153047
  • wu:fi41h04
  • CH1073-226M24.2
  • cyclin Y-like 1
  • ccnyl1-a
  • ccnyl1
  • LOC100356703
  • CCNYL1
  • Ccnyl1
Epitop
N-Term
10
1
1
1
1
Reaktivität
Human
32
20
19
8
3
3
3
3
2
2
1
Wirt
Kaninchen
32
Klonalität
Polyklonal
Konjugat
Dieser CCNYL1 Antikörper ist unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
18
13
8
8
6
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CCNYL1(cyclin Y-like 1) The peptide sequence was selected from the N terminal of CCNYL1. Peptide sequence TVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKF.
Reinigung Immunogen affinity purified
Andere Bezeichnung CCNYL1
Hintergrund Gene Symbol: CCNYL1
Molekulargewicht Theoretical MW: 33 kDa
Gen-ID 151195
Forschungsgebiet Cell Cycle
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CCNYL1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?