Cyclin B3 Antikörper (CCNB3) (C-Term)

Details for Product anti-CCNB3 Antibody No. ABIN4258844, Anbieter: Anmelden zum Anzeigen
Antigen
  • CG5814
  • Cyc B3
  • Dmel\\CG5814
  • anon-WO0118547.414
  • cycB3
  • l(3)L6540
  • ccnb3-a
  • zgc:153369
  • MGC154490
  • NV16541
  • CCNB3
  • CYCB3
  • RGD1564367
  • Cyclin B3
  • cyclin B3
  • CycB3
  • ccnb3
  • cycb3
  • AaeL_AAEL009572
  • cycB3
  • CCNB3
  • Ccnb3
Epitop
C-Term
20
20
20
18
18
18
18
18
8
6
5
2
2
2
1
1
1
1
1
1
1
Reaktivität
Human
77
65
51
21
1
Wirt
Kaninchen
181
2
Klonalität
Polyklonal
Konjugat
Dieser Cyclin B3 Antikörper ist unkonjugiert
16
16
16
16
16
16
Applikation
Western Blotting (WB)
139
120
27
3
3
3
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the C terminal of human CCNB3. Peptide sequence ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLE.
Reinigung Immunogen affinity purified
Andere Bezeichnung CCNB3 (CCNB3 Antibody Abstract)
Hintergrund Gene Symbol: CCNB3
Gen-ID 85417
NCBI Accession NP_149020
Pathways Zellzyklus, Chromatin Binding
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CCNB3 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?