Chemokine (C-C Motif) Ligand 8 (CCL8) Antikörper

Details zu Produkt Nr. ABIN4258837, Anbieter: Anmelden zum Anzeigen
Antigen
  • HC14
  • MCP-2
  • MCP2
  • SCYA10
  • SCYA8
  • 1810063B20Rik
  • AB023418
  • Mcp2
  • Scya8
  • chemokine (C-C motif) ligand 8
  • monocyte chemoattractant protein-2 precursor
  • CCL8
  • Ccl8
  • MCP-2
Reaktivität
Human
91
51
3
2
1
Wirt
Kaninchen
72
39
15
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
15
7
6
4
4
3
3
3
3
3
3
3
3
3
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
101
57
15
14
8
7
4
4
4
3
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the middle region of human CCL8. Peptide sequence SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP.
Reinigung Immunogen affinity purified
Andere Bezeichnung CCL8/MCP-2 (CCL8 Antibody Abstract)
Hintergrund Gene Symbol: CCL8
Molekulargewicht Theoretical MW: 9 kDa
Gen-ID 6355
NCBI Accession NP_005614
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CCL8 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?