DARPP32 Antikörper (N-Term)

Produktnummer ABIN3044534

Produktdetails anti-DARPP32 Antikörper

Target: DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))

Bindungsspezifität: AA 1-36, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DARPP32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: MDPKDRKKIQ FSVPAPPSQL DPRQVEMIRR RRPTPA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein phosphatase 1 regulatory inhibitor subunit 1B
Protein Name: Protein phosphatase 1 regulatory subunit 1B

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu DARPP32

Target: DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))

Andere Bezeichnung: PPP1R1B (PPP1R1B Produkte)

Synonyme: darpp32 antikoerper, darpp-32 antikoerper, Darpp-32 antikoerper, Darpp32 antikoerper, DARPP-32 antikoerper, DARPP32 antikoerper, AU040756 antikoerper, protein phosphatase 1 regulatory inhibitor subunit 1B antikoerper, protein phosphatase 1, regulatory (inhibitor) subunit 1B antikoerper, protein phosphatase 1 regulatory inhibitor subunit 1B S homeolog antikoerper, ppp1r1b antikoerper, PPP1R1B antikoerper, Ppp1r1b antikoerper, ppp1r1b.S antikoerper

Hintergrund: Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms: DARPP 32 antibody|DARPP-32 antibody|Dopamine and cAMP regulated neuronal phosphoprotein 32 antibody|Dopamine and cAMP regulated neuronal phosphoprotein antibody|Dopamine and cAMP regulated phosphoprotein antibody|Dopamine and cAMP regulated phosphoprotein DARPP 32 antibody|Dopamine and cAMP regulated phosphoprotein DARPP32 antibody|Dopamine- and cAMP-regulated neuronal phosphoprotein antibody| FLJ20940 antibody|IPPD antibody|Neuronal phosphoprotein DARPP 32 antibody|PPP1R1B antibody|PPR1B_HUMAN antibody|Protein phosphatase 1 regulatory (inhibitor) subunit 1B antibody|Protein phosphatase 1 regulatory subunit 1B antibody

Gen-ID: 84152