PTPN11 Antikörper (N-Term)
-
- Target Alle PTPN11 Antikörper anzeigen
- PTPN11 (Protein tyrosine Phosphatase, Non-Receptor Type 11 (PTPN11))
-
Bindungsspezifität
- AA 69-99, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PTPN11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 11(PTPN11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- EKFATLAELV QYYMEHHGQL KEKNGDVIEL K
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 11(PTPN11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein tyrosine phosphatase, non-receptor type 11
Protein Name: Tyrosine-protein phosphatase non-receptor type 11 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product PTPN11 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PTPN11 (Protein tyrosine Phosphatase, Non-Receptor Type 11 (PTPN11))
- Andere Bezeichnung
- PTPN11 (PTPN11 Produkte)
- Synonyme
- BPTP3 antikoerper, CFC antikoerper, NS1 antikoerper, PTP-1D antikoerper, PTP2C antikoerper, SH-PTP2 antikoerper, SH-PTP3 antikoerper, SHP2 antikoerper, 2700084A17Rik antikoerper, AW536184 antikoerper, PTP1D antikoerper, SAP-2 antikoerper, SHP-2 antikoerper, Shp2 antikoerper, Syp antikoerper, SYP antikoerper, bptp3 antikoerper, cfc antikoerper, ns1 antikoerper, ptp-2 antikoerper, ptp2c antikoerper, ptpn11 antikoerper, ptpn11-a antikoerper, ptpn11-b antikoerper, shp-2 antikoerper, shp2 antikoerper, fa14b09 antikoerper, wu:fa14b09 antikoerper, wu:fi24f03 antikoerper, zgc:55388 antikoerper, zgc:63553 antikoerper, protein tyrosine phosphatase, non-receptor type 11 antikoerper, protein tyrosine phosphatase, non-receptor type 11 S homeolog antikoerper, protein tyrosine phosphatase, non-receptor type 11, a antikoerper, protein tyrosine phosphatase, non-receptor type 11, b antikoerper, PTPN11 antikoerper, Ptpn11 antikoerper, ptpn11.S antikoerper, ptpn11a antikoerper, ptpn11b antikoerper
- Substanzklasse
- Viral Protein
- Hintergrund
-
PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1,779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
Synonyms: BPTP 3 antibody|BPTP3 antibody|CFC antibody|MGC14433 antibody|Noonan syndrome 1 antibody|Noonan syndrome 1 protein tyrosine phosphatase 2C antibody|NS 1 antibody|NS1 antibody|OTTHUMP00000166107 antibody|OTTHUMP00000166108 antibody|Protein tyrosine phosphatase 2 antibody|Protein tyrosine phosphatase 2C antibody|Protein Tyrosine Phosphatase Non receptor Type 11 antibody|Protein-tyrosine phosphatase 1D antibody|Protein-tyrosine phosphatase 2C antibody|PTN11_HUMAN antibody|PTP 1D antibody|PTP 2C antibody|PTP-1D antibody|PTP-2C antibody|PTP1D antibody|PTP2C antibody|PTPN 11 antibody|PTPN11 antibody|PTPN11 antibody|SAP2 antibody|SH PTP2 antibody|SH PTP3 antibody|SH-PTP2 antibody|SH-PTP3 antibody|SH2 domain containing protein tyrosine phosphatase 2 antibody|SHIP2 antibody|SHP 2 antibody|SHP-2 antibody|Shp2 antibody|SHPTP 2 antibody|SHPTP2 antibody|SHPTP3 antibody|SIT protein precursor antibody| Syp antibody|Tyrosine protein phosphatase non receptor type 11 antibody|Tyrosine-protein phosphatase non-receptor type 11 antibody - Gen-ID
- 5781
- UniProt
- Q06124
- Pathways
- JAK-STAT Signalweg, RTK Signalweg, T-Zell Rezeptor Signalweg, Interferon-gamma Pathway, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Toll-Like Receptors Cascades, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, BCR Signaling, Warburg Effekt
-