IGFBP3 Antikörper (C-Term)

Produktnummer ABIN3043859

Produktdetails anti-IGFBP3 Antikörper

Target: IGFBP3 (Insulin-Like Growth Factor Binding Protein 3 (IGFBP3))

Bindungsspezifität: AA 214-252, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGFBP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human,Rat.

Sequenz: RREMEDTLNH LKFLNVLSPR GVHIPNCDKK GFYKKKQCR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
Gene Name: insulin-like growth factor binding protein 3
Protein Name: Insulin-like growth factor-binding protein 3

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-IGFBP3 Antikörper (ABIN3043859)

Pu, Wen, Liu, Zheng, Xiao, Xu, Wang, Li, Zhang: "shRNA constructs targeting IGFBP-3 alleviate age related erectile dysfunction in the rat." in: The Journal of urology, Vol. 192, Issue 3, pp. 990-6, (2014) (PubMed).

Pu, Zheng, Zhang, Xiao, Xu, Liu, Wang, Wen, Zhou, Wu: "Higher expression of mRNA and protein of insulin-like growth factor binding protein-3 in old rat penile tissues: implications for erectile dysfunction." in: The journal of sexual medicine, Vol. 8, Issue 8, pp. 2181-90, (2011) (PubMed).

Details zu IGFBP3

Target: IGFBP3 (Insulin-Like Growth Factor Binding Protein 3 (IGFBP3))

Andere Bezeichnung: IGFBP3 (IGFBP3 Produkte)

Synonyme: BP-53 antikoerper, IBP3 antikoerper, AI649005 antikoerper, IGFBP-3 antikoerper, IGgfbp3 antikoerper, IGF-BP3 antikoerper, zgc:91788 antikoerper, IGFBP3 antikoerper, igfbp3 antikoerper, insulin like growth factor binding protein 3 antikoerper, insulin-like growth factor binding protein 3 antikoerper, IGFBP3 antikoerper, Igfbp3 antikoerper, igfbp3 antikoerper, IGFBP-3 antikoerper, LOC100305016 antikoerper

Hintergrund: IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Synonyms: Acid stable subunit of the 140 K IGF complex antibody|Binding protein 29 antibody|Binding protein 53 antibody|BP 53 antibody|BP53 antibody|Growth hormone dependent binding protein antibody|IBP 3 antibody|IBP-3 antibody|IBP3 antibody|IBP3_HUMAN antibody|IGF binding protein 3 antibody|IGF-binding protein 3 antibody|IGFBP 3 antibody|IGFBP-3 antibody|IGFBP3 antibody|Insulin Like Growth Factor Binding Protein 3 antibody|Insulin-like growth factor-binding protein 3 antibody

Gen-ID: 3486

UniProt: P17936

Pathways: Myometrial Relaxation and Contraction, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process, Autophagie, Smooth Muscle Cell Migration, Growth Factor Binding