HSPA9 Antikörper (C-Term)

Produktnummer ABIN3043853

Produktdetails anti-HSPA9 Antikörper

Target: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Bindungsspezifität: AA 646-679, C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPA9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KLFEMAYKKM ASEREGSGSS GTGEQKEDQK EEKQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock 70 kDa protein 9 (mortalin)
Protein Name: Stress-70 protein, mitochondrial

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu HSPA9

Target: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Andere Bezeichnung: HSPA9 (HSPA9 Produkte)

Synonyme: APG-2 antikoerper, HS24/P52 antikoerper, HSPH2 antikoerper, RY antikoerper, hsp70 antikoerper, hsp70RY antikoerper, CSA antikoerper, GRP-75 antikoerper, GRP75 antikoerper, HSPA9B antikoerper, MOT antikoerper, MOT2 antikoerper, MTHSP75 antikoerper, PBP74 antikoerper, Hspa9a antikoerper, csa antikoerper, grp-75 antikoerper, grp75 antikoerper, hspa9 antikoerper, hspa9b antikoerper, mortalin antikoerper, mot antikoerper, mot2 antikoerper, pbp74 antikoerper, mot-2 antikoerper, mthsp75 antikoerper, 74kDa antikoerper, Csa antikoerper, Grp75 antikoerper, Hsc74 antikoerper, Hsp74 antikoerper, Hsp74a antikoerper, Mortalin antikoerper, Mot-2 antikoerper, Mot2 antikoerper, Mthsp70 antikoerper, Pbp74 antikoerper, cb740 antikoerper, crs antikoerper, wu:fc14d08 antikoerper, wu:fc27c10 antikoerper, wu:fc38a06 antikoerper, heat shock protein family A (Hsp70) member 4 antikoerper, heat shock protein family A (Hsp70) member 9 antikoerper, heat shock protein family A member 9 antikoerper, heat shock protein family A (Hsp70) member 9 S homeolog antikoerper, stress-70 protein, mitochondrial antikoerper, heat shock protein 9 antikoerper, heat shock protein Hsp9 antikoerper, HSPA4 antikoerper, HSPA9 antikoerper, Hspa9 antikoerper, hspa9.S antikoerper, hspa9 antikoerper, LOC577721 antikoerper, hsp9 antikoerper

Hintergrund: HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

Synonyms: 75 kDa glucose regulated protein antibody|75 kDa glucose-regulated protein antibody|CSA antibody|Glucose Regulated Protein antibody| Grp 75 antibody|GRP-75 antibody|GRP75 antibody| GRP75_HUMAN antibody|Heat shock 70 kDa protein 9 antibody|Heat shock 70kD protein 9 antibody|heat shock 70 kDa protein 9 antibody|Heat shock 70 kDa protein 9B antibody|Heat shock protein 74 kDa A antibody|Heat shock protein A antibody|Heat shock protein cognate 74 antibody|Hsc74 antibody|Hsp74 antibody|Hsp74a antibody|HSPA9 antibody|Hspa9a antibody|HSPA9B antibody|MGC4500 antibody|mitochondrial antibody|Mortalin 2 antibody|Mortalin antibody|Mortalin perinuclear antibody| Mortalin2 antibody|MOT 2 antibody|MOT antibody|MOT2 antibody|Mthsp70 antibody|p66 mortalin antibody|P66 MOT antibody|PBP74 antibody| Peptide binding protein 74 antibody|Peptide-binding protein 74 antibody|Stress 70 protein mitochondrial antibody|Stress 70 protein mitochondrial precursor antibody|Stress-70 protein antibody

Gen-ID: 3313

UniProt: P38646