TREX1 Antikörper (Middle Region)

Produktnummer ABIN3043537

Produktdetails anti-TREX1 Antikörper

Target: TREX1 (three Prime Repair Exonuclease 1 (TREX1))

Bindungsspezifität: AA 156-185, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TREX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.

Sequenz: DDNLANLLLA FLRRQPQPWC LVAHNGDRYD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.
Gene Name: three prime repair exonuclease 1
Protein Name: Three-prime repair exonuclease 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TREX1 (156-185aa DDNLANLLLAFLRRQPQPWCLVAHNGDRYD), different from the related mouse sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu TREX1

Target: TREX1 (three Prime Repair Exonuclease 1 (TREX1))

Andere Bezeichnung: TREX1 (TREX1 Produkte)

Synonyme: AGS1 antikoerper, CRV antikoerper, DRN3 antikoerper, HERNS antikoerper, 1661 antikoerper, AU041952 antikoerper, RGD1309596 antikoerper, three prime repair exonuclease 1 antikoerper, CpipJ_CPIJ012074 antikoerper, Tsp_03749 antikoerper, TREX1 antikoerper, Trex1 antikoerper

Hintergrund: Three prime repair exonuclease 1 is an enzyme that in humans is encoded by the TREX1 gene. This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.

Synonyms: 3' 5' exonuclease TREX1 antibody|3' repair exonuclease 1 antibody|AGS1 antibody|AGS5 antibody|CRV antibody|Deoxyribonuclease III, dnaQ/mutD (E. coli) like antibody|DKFZp434J0310 antibody|DNase III antibody|DRN3 antibody|HERNS antibody|Three prime repair exonuclease 1 antibody|TREX1 antibody

Gen-ID: 11277

Pathways: Apoptose