TCP1 alpha/CCTA Antikörper (C-Term)

Produktnummer ABIN3043417

Produktdetails anti-TCP1 alpha/CCTA Antikörper

Target: TCP1 alpha/CCTA (TCP1) (T-Complex 1 (TCP1))

Bindungsspezifität: AA 515-551, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TCP1 alpha/CCTA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit alpha(TCP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KFATEAAITI LRIDDLIKLH PESKDDKHGS YEDAVHS

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit alpha(TCP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: t-complex 1
Protein Name: T-complex protein 1 subunit alpha

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-TCP1 alpha/CCTA Antikörper (ABIN3043417)

Gong, Guo, Huang, Sun: "Inhaled nitric oxide alleviates hyperoxia suppressed phosphatidylcholine synthesis in endotoxin-induced injury in mature rat lungs." in: Respiratory research, Vol. 7, pp. 5, (2006) (PubMed).

Details zu TCP1 alpha/CCTA

Target: TCP1 alpha/CCTA (TCP1) (T-Complex 1 (TCP1))

Andere Bezeichnung: TCP1 (TCP1 Produkte)

Synonyme: CCT-alpha antikoerper, CCT1 antikoerper, CCTa antikoerper, D6S230E antikoerper, TCP-1-alpha antikoerper, AI528772 antikoerper, CCT antikoerper, Cct1 antikoerper, Ccta antikoerper, TRic antikoerper, Tcp-1 antikoerper, Tp63 antikoerper, c-cpn antikoerper, p63 antikoerper, TRiC antikoerper, CCTalpha antikoerper, BEST:GH05123 antikoerper, CG5374 antikoerper, Dmel\\CG5374 antikoerper, T-cpl antikoerper, TCP-1alpha antikoerper, TCPA_DROME antikoerper, Tcp1 antikoerper, Tcp1-alpha antikoerper, gh05123 antikoerper, cct-alpha antikoerper, ccta antikoerper, tcp1 antikoerper, tcp1-a antikoerper, tcp1a antikoerper, tcp1alpha antikoerper, CHUNP6875 antikoerper, fa13h08 antikoerper, wu:fa13h08 antikoerper, wu:fc95g06 antikoerper, t-complex 1 antikoerper, T-complex protein 1 subunit alpha antikoerper, t-complex protein 1 antikoerper, Tcp1-like antikoerper, t-complex 1 S homeolog antikoerper, TCP1 antikoerper, cct-1 antikoerper, Tcp1 antikoerper, T-cp1 antikoerper, tcp1.S antikoerper, tcp1 antikoerper

Hintergrund: T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.

Synonyms: AI528772 antibody|c-cpn antibody|CCT alpha antibody|CCT antibody|CCT-alpha antibody|CCT1 antibody|Ccta antibody|CCTalpha antibody| D6S230E antibody|MGC133746 antibody|p63 antibody|T complex 1 antibody|T complex protein 1 alpha subunit antibody|T complex protein 1 antibody|T-complex homolog TCP1 antibody|T-complex protein 1 subunit alpha antibody|T-complex protein 1 subunit alpha B antibody| Tailless complex polypeptide 1 antibody|Tailless complex polypeptide 1A antibody|Tailless complex polypeptide 1B antibody|TCP 1 alpha antibody|Tcp-1 antibody|TCP-1-alpha antibody|TCP1 antibody|TCPA_HUMAN antibody|Tp63 antibody|TRic antibody

Gen-ID: 6950

UniProt: P17987