MMP12 Antikörper (C-Term)
-
- Target Alle MMP12 Antikörper anzeigen
- MMP12 (Matrix Metallopeptidase 12 (Macrophage Elastase) (MMP12))
-
Bindungsspezifität
- AA 432-466, C-Term
-
Reaktivität
- Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MMP12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), ELISA
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Macrophage metalloelastase(MMP12) detection. Tested with WB, ELISA in Mouse.
- Sequenz
- KIDAVLYFKR HYYIFQGAYQ LEYDPLFRRV TKTLK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Macrophage metalloelastase(MMP12) detection. Tested with WB, ELISA in Mouse.
Gene Name: matrix metallopeptidase 12 (macrophage elastase)
Protein Name: Macrophage metalloelastase - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product MMP12 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- MMP12 (Matrix Metallopeptidase 12 (Macrophage Elastase) (MMP12))
- Andere Bezeichnung
- MMP12 (MMP12 Produkte)
- Synonyme
- MMP12 antikoerper, AV378681 antikoerper, Mmel antikoerper, Mme antikoerper, HME antikoerper, ME antikoerper, MME antikoerper, MMP-12 antikoerper, matrix metallopeptidase 12 antikoerper, MMP12 antikoerper, Mmp12 antikoerper
- Hintergrund
-
Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling.
Synonyms: EC 3.4.24.65 antibody|HME antibody|Macrophage elastase antibody|Macrophage metalloelastase antibody|Macrophage metaloelastase antibody|Matrix metallopeptidase 12 (macrophage elastase) antibody|Matrix metalloprotease 12 antibody|Matrix metalloproteinase-12 antibody|ME antibody|MGC138506 antibody|MME antibody|MMP 12 antibody|MMP-12 antibody|Mmp12 antibody|MMP12_HUMAN antibody - Gen-ID
- 17381
- UniProt
- P34960
-