KCNIP2 Antikörper (N-Term)

Produktnummer ABIN3043273

Produktdetails anti-KCNIP2 Antikörper

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Bindungsspezifität: AA 78-112, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNIP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Kv channel-interacting protein 2(KCNIP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: DEFELSTVCH RPEGLEQLQE QTKFTRKELQ VLYR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Kv channel-interacting protein 2(KCNIP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: Kv channel interacting protein 2
Protein Name: Kv channel-interacting protein 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu KCNIP2

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Andere Bezeichnung: KCNIP2 (KCNIP2 Produkte)

Synonyme: KCHIP2 antikoerper, KCNIP2 antikoerper, Kchip2 antikoerper, KChIP2 antikoerper, kchip2 antikoerper, si:ch73-173h19.2 antikoerper, potassium voltage-gated channel interacting protein 2 antikoerper, Kv channel-interacting protein 2 antikoerper, Kv channel interacting protein 2 S homeolog antikoerper, Kv channel interacting protein 2 antikoerper, KCNIP2 antikoerper, Kcnip2 antikoerper, kcnip2.S antikoerper, kcnip2 antikoerper

Hintergrund: Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.

Synonyms: A type potassium channel modulatory protein 2 antibody|A-type potassium channel modulatory protein 2 antibody|Cardiac voltage gated potassium channel modulatory subunit antibody|Cardiac voltage-gated potassium channel modulatory subunit antibody|DKFZp566L1246 antibody|KChIP 2 antibody|KChIP2 antibody|KCIP2_HUMAN antibody|KCNIP 2 antibody|Kcnip2 antibody|Kv channel interacting protein 2 antibody|Kv channel-interacting protein 2 antibody|MGC17241 antibody|Potassium channel interacting protein 2 antibody|Potassium channel-interacting protein 2 antibody

Gen-ID: 30819