Kv1.4 Antikörper (C-Term)

Produktnummer ABIN3043264

Produktdetails anti-Kv1.4 Antikörper

Target: Kv1.4 (KCNA4) (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 4 (KCNA4))

Bindungsspezifität: AA 609-647, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Kv1.4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 4(KCNA4) detection. Tested with WB, IHC-P in Human.

Sequenz: SEYLEMEEGV KESLCAKEEK CQGKGDDSET DKNNCSNAK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 4(KCNA4) detection. Tested with WB, IHC-P in Human.
Gene Name: potassium voltage-gated channel, shaker-related subfamily, member 4
Protein Name: Potassium voltage-gated channel subfamily A member 4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Kv1.4

Target: Kv1.4 (KCNA4) (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 4 (KCNA4))

Andere Bezeichnung: KCNA4 (KCNA4 Produkte)

Synonyme: KV1.4 antikoerper, KCNA4 antikoerper, Kv1.4 antikoerper, DKFZp459N0126 antikoerper, KCHAN antikoerper, Kv4 antikoerper, RHK1 antikoerper, RK3 antikoerper, HBK4 antikoerper, HK1 antikoerper, HPCN2 antikoerper, HUKII antikoerper, KCNA4L antikoerper, KCNA8 antikoerper, PCN2 antikoerper, potassium voltage-gated channel subfamily A member 4 antikoerper, potassium voltage-gated channel subfamily A member 4 S homeolog antikoerper, potassium voltage-gated channel, shaker-related subfamily, member 4 antikoerper, KCNA4 antikoerper, LOC100622932 antikoerper, kcna4.S antikoerper, Kcna4 antikoerper

Hintergrund: Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, is a protein that in humans is encoded by the KCNA4 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It is mapped to 11p14.1. KCNA4 belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential. KCNA4 also contributes to the cardiac transient outward potassium current (Ito1), the main contributing current to the repolarizing phase 1 of the cardiac action potential. This gene has been shown to interact with DLG4, KCNA2 and DLG1.

Synonyms: Voltage gated K+ channel HuKII antibody|cardiac potassium channel antibody|fetal skeletal muscle potassium channel antibody|HBK 4 antibody|HBK4 antibody|HK 1 antibody|HK1 antibody|HPCN 2 antibody|HPCN2 antibody|HUK II antibody|HUKII antibody|KCNA 4 antibody|KCNA 8 antibody|KCNA4 antibody|KCNA4_HUMAN antibody|KCNA4L antibody|KCNA8 antibody|kv1.4 antibody|PCN 2 antibody|PCN2 antibody|potassium channel 2 antibody|potassium channel KCNA4 antibody|potassium channel protein antibody|Potassium voltage gated channel shaker related subfamily member 4 antibody|Potassium voltage gated channel subfamily A member 4 antibody|potassium voltage-gated channel shaker-related subfamily member 4-like antibody|Potassium voltage-gated channel subfamily A member 4 antibody|rapidly inactivating potassium channel antibody|Shaker related potassium channel Kv1.4 antibody|shaker-related potassium channel Kv1.4 antibody|type A potassium channel antibody|Voltage gated potassium channel HBK4 antibody|Voltage gated potassium channel HK1 antibody|Voltage gated potassium channel subunit Kv1.4 antibody|Voltage-gated K(+) channel HuKII antibody|voltage-gated potassium channel antibody|Voltage-gated potassium channel HBK4 antibody|Voltage-gated potassium channel HK1 antibody|voltage-gated potassium channel protein Kv1.4 antibody| Voltage-gated potassium channel subunit Kv1.4 antibody

Gen-ID: 3739

UniProt: P22459