CRY2 Antikörper (N-Term)

Produktnummer ABIN3042760

Produktdetails anti-CRY2 Antikörper

Target: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Bindungsspezifität: AA 171-200, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRY2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Cryptochrome-2(CRY2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: RFQAIISRME LPKKPVGLVT SQQMESCRAE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Cryptochrome-2(CRY2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cryptochrome circadian clock 2
Protein Name: Cryptochrome-2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CRY2 (171-200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE), different from the related mouse and rat sequences by five amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CRY2

Target: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Andere Bezeichnung: CRY2 (CRY2 Produkte)

Synonyme: Cry2 antikoerper, Cry antikoerper, GB10211 antikoerper, CRY2 antikoerper, AT-PHH1 antikoerper, ATCRY2 antikoerper, CRYPTOCHROME 2 APOPROTEIN antikoerper, F19P19.14 antikoerper, F19P19_14 antikoerper, FHA antikoerper, PHH1 antikoerper, cryptochrome 2 antikoerper, HCRY2 antikoerper, PHLL2 antikoerper, AV006279 antikoerper, D130054K12Rik antikoerper, gCry2 antikoerper, cryptochrome circadian regulator 2 antikoerper, cryptochrome 2 antikoerper, cryptochrome Cry2 antikoerper, cryptochrome circadian clock 2 antikoerper, cryptochrome 2 (photolyase-like) antikoerper, CRY2 antikoerper, Cry2 antikoerper, cry2 antikoerper, LOC100502533 antikoerper

Hintergrund: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.

Synonyms: cry2 antibody|CRY2_HUMAN antibody|cryptochrome 2 (photolyase like) antibody|Cryptochrome 2 antibody|Cryptochrome-2 antibody|FLJ10332 antibody|growth inhibiting protein 37 antibody|HCRY2 antibody|KIAA0658 antibody|PHLL2 antibody|Photolyase like antibody

Gen-ID: 1408

Pathways: Response to Water Deprivation, Protein targeting to Nucleus