HAVCR1 Antikörper (Hepatitis A Virus Cellular Receptor 1) (AA 321-359)

Details for Product anti-HAVCR1 Antibody No. ABIN3042438, Anbieter: Anmelden zum Anzeigen
Antigen
  • HAVCR1
  • LOC100226241
  • AI503787
  • KIM-1
  • TIM-1
  • Tim1
  • Timd1
  • HAVCR
  • HAVCR-1
  • KIM1
  • TIM
  • TIM1
  • TIMD-1
  • TIMD1
  • Kim1
  • hepatitis A virus cellular receptor 1
  • Rho guanine nucleotide exchange factor (GEF) 5
  • RCJMB04_10h2
  • HAVCR1
  • LOC100226241
  • Havcr1
  • Arhgef5
Epitop
AA 321-359, C-Term
18
9
8
8
7
6
6
6
6
5
5
5
5
5
5
5
4
4
3
3
3
3
2
2
2
1
1
1
1
1
1
Reaktivität
Human
91
42
26
11
6
1
1
1
Wirt
Kaninchen
108
34
8
5
Klonalität
Polyklonal
Konjugat
Dieser HAVCR1 Antikörper ist unkonjugiert
13
11
5
5
3
3
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
109
88
20
19
18
11
7
4
4
4
2
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Verwendungszweck Rabbit IgG polyclonal antibody for Hepatitis A virus cellular receptor 1(HAVcr-1)(HAVCR1) detection. Tested with WB in Human.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD).
Sequenz QQLSVSFSSL QIKALQNAVE KEVQAEDNIY IENSLYATD
Isotyp IgG
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Hepatitis A virus cellular receptor 1(HAVcr-1)(HAVCR1) detection. Tested with WB in Human.
Gene Name: hepatitis A virus cellular receptor 1
Protein Name: Hepatitis A virus cellular receptor 1(HAVcr-1)
Reinigung Immunogen affinity purified.
Andere Bezeichnung HAVCR1 (HAVCR1 Antibody Abstract)
Hintergrund KIM1 (KIDNEY INJURY MOLECULE 1), also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the KIM1 gene. The KIM1 gene is mapped to 5q33.3. Biochemical, mutational, and cell adhesion analyses confirm that Tim1 is capable of homophilic Tim-Tim interactions. The features identified in murine KIM1 are conserved in human KIM1. The KIM1 protein is indeed a receptor for the virus through the infection of canine osteogenic sarcoma cells expressing HAVCR1 with HAV. Using a monoclonal antibody to mouse Tim1, Tim1 is expressed after activation of naive T cells and on T cells differentiated in Th2-polarizing conditions. Ectopic expression of KIM1 during mouse T-cell differentiation leads to production of the Th2-type cytokine Il4, but not the Th1-type cytokine Ifng. KIM1-expressing epithelial cells internalized apoptotic bodies, and Kim1 is directly responsible for phagocytosis in cultured primary rat tubule epithelial cells and in porcine and canine epithelial cell lines.

Synonyms: HAVCR 1 antibody|HAVcr-1 antibody|HAVCR1 antibody|Hepatitis A virus cellular receptor 1 antibody|Kidney injury molecule 1 antibody|KIM 1 antibody|KIM-1 antibody|T cell immunoglobin domain and mucin domain protein 1 antibody|T-cell immunoglobulin and mucin domain-containing protein 1 antibody|T-cell membrane protein 1 antibody|TIM antibody|TIM-1 antibody|TIM1 antibody|TIMD 1 antibody|TIMD-1 antibody|TIMD1 antibody|TIMD1_HUMAN antibody
Gen-ID 26762
UniProt Q96D42
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
Bilder des Herstellers
Western Blotting (WB) image for anti-HAVCR1 Antikörper (Hepatitis A Virus Cellular Receptor 1) (AA 321-359) (ABIN3042438) anti-Hepatitis A Virus Cellular Receptor 1 (HAVCR1) (AA 321-359), (C-Term) antibody